PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10426233g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 1021aa    MW: 111282 Da    PI: 5.5673
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10426233g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.5e-1967113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEdel+v++v+++G++ W+ I++ ++ gR +kqc++rw+++l
  MA_10426233g0010  67 KGPWTKEEDELIVELVRKYGSKKWSVISQSLP-GRIGKQCRERWHNHL 113
                       79******************************.*************97 PP

2Myb_DNA-binding53.46e-17119161145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +++W+++E+  l++a++ +G++ W+ Ia+ ++ gRt++++k++w+
  MA_10426233g0010 119 KDAWSQDEEMALIRAHQIYGNK-WAEIAKSLP-GRTDNSIKNHWN 161
                       679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.9614261IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.9E-114374IPR009057Homeodomain-like
PROSITE profilePS5129431.43962117IPR017930Myb domain
SuperFamilySSF466892.55E-3164160IPR009057Homeodomain-like
SMARTSM007172.9E-1866115IPR001005SANT/Myb domain
PfamPF002492.0E-1867113IPR001005SANT/Myb domain
CDDcd001672.32E-1669113No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2675120IPR009057Homeodomain-like
PROSITE profilePS5129421.338118168IPR017930Myb domain
SMARTSM007174.5E-17118166IPR001005SANT/Myb domain
PfamPF002491.9E-15119162IPR001005SANT/Myb domain
CDDcd001673.55E-13121161No hitNo description
Gene3DG3DSA:1.10.10.604.9E-23121168IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1021 aa     Download sequence    Send to blast
MSVVLLSGRK NSSLWSQRFC LATGLSANMR FGPAMSLGSH GTEYFSDRTD VQCLHRWQKV  60
LNPELVKGPW TKEEDELIVE LVRKYGSKKW SVISQSLPGR IGKQCRERWH NHLNPEIKKD  120
AWSQDEEMAL IRAHQIYGNK WAEIAKSLPG RTDNSIKNHW NSSIKKKLDS YLASGLSIQL  180
PELPTAQPTL LSALSTAAET SSDVVMAGTV GEQQFVCSQE SVSRVGIQSG MLEVATTSTL  240
QLGDTNLDLK KTERDRRLVD EVKDSPNPSL PLCFETDGSV CLTADGMPEF SGVGRDKAAM  300
PMPSYQMNDF LESVISGNAF SVGSPQEVSN AGNLSNCVAS TALGYHSIAP SSDAEHKSSS  360
FIHRYQLSSC CDVAMSSPKA CTSAAFSASW SPLGSGAPDV SLSSFIDKKQ LLCSPEKPVS  420
AIDGGTCSSS EIRHCDELLQ VCLPSSESLK LANQDERPRS TLLSMTADVN RKVVCEIDAG  480
GNPDVQSENS NSESLFYEPP RLSNWDIPFV NCDLINSCGY LHQAYSPLGV RQMIMSSVDC  540
FSPCNGWGSA FNEKSPESIL KSAAKSFTNT PSIVRKRSRD ASTPVDANRN GKAADKVKTH  600
DNFITPGSLT RKYNELLESP DDGISGPGLC QSKRQTLVSP QYCLKTKHFA PVKSMERHLE  660
YASEATKGLD PGYRWSSPSP MKNSGGSESD VRQSNKGVDP SGWKVSNREC TQRDVRDMNK  720
IDHGARMQNM QSYGVLVEQN LNGQQFFQTI GDNSLKFGSP SASTVIPKSH SGRSMGISGK  780
LKVSEGDTEM RASGFVSSPC NITRKMVTTN IESSTVIASA NPLHHAFDID WLNNIPDLDN  840
LSIMGSASGL DKGLGSPIEW KSPWSLDPYF SAQKNSTDTF LEEMGIFLNH EDGTDDALGL  900
IQHLNEHAAS AYLEAEEILA TDPAKEPPSL MVQASPTFQD KTAEDDSSCK ENMFSLDTTF  960
GADNSSPLFS CLSPFPVDFA QVYNTPCRSG GFSGGAETNQ NFAGNTNDFS SPSLYLRKEF  1020
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-624416835159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-624416835159MYB PROTO-ONCOGENE PROTEIN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1129460.0BT112946.1 Picea glauca clone GQ03323_C20 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.22e-73myb domain protein 3r-4